PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000511G0500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 187aa    MW: 20182.5 Da    PI: 7.9037
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000511G0500genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-14121172556
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      +r + ++kNRe+A rsR+RK+a + eLe++v+ L++eN++L+ + e+  ++ 
  PH01000511G0500 121 RRKKCMIKNRESAARSRARKQAHVSELEREVQYLQQENEKLRVKYEQVIETR 172
                      788899************************************9988876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-10117183IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507119168IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-13121173No hitNo description
CDDcd147079.04E-18121167No hitNo description
PfamPF001706.1E-13121169IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-12121172No hitNo description
PROSITE patternPS000360124139IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MEDEEDMWAN TTNPSALPTA ASTCSSISTA LNLNSTHLHL YSGASPPHSR DNNYNGSMGC  60
AGYRNAVASP ASFFSSAGSY PHIAPLDAGL ARRALEREMC LGHAAAPWAG AGAAAAGGGD  120
RRKKCMIKNR ESAARSRARK QAHVSELERE VQYLQQENEK LRVKYEQVIE TRCSVNLLAM  180
YSPPPND
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0995540.0FP099554.1 Phyllostachys edulis cDNA clone: bphylf046e04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.13e-50PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0K2QPS34e-97A0A0K2QPS3_9POAL; FD-like protein
STRINGSi031077m8e-50(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.21e-14basic region/leucine zipper motif 27